Saphire clear cluster
Top sales list saphire clear cluster
South Africa (All cities)
Cluster Scratch Protection Film Screen Protector For Ducati Multistrada 15-17 Package weight: 0.09 kg Description: Instrument protective film adopts high quality TPU explosion-proof membrane Protect the cluster screen from scratches, dust, debris, heat and ultraviolet light Easy to clean and erase dirt, no fear, scratches cluster screen Leave no residue when removed Equipped with cleaning kit and scraping Specification: Product: Motorcycle Instrument Screen Protector Material: Thermoplastic polyurethanes(TPU) Color: Clear Size: 158mm * 110mm Fitment: For Ducati Multistrada 1200 2015-2016 For Ducati Multistrada 1200 S 2015-2017 Method of Application: The meter is cleaned, the number 1 at the end of tear film, and then in the middle of the film is sprayed with appropriate water, put in the car in the middle of the water meter, scrape shift positions, shave after the 2 top film (yellow) with a slight tear, blisters, after 24 hours will be eliminated. Note: Comes with Cleaning kit, Squeegee and Detailed Instruction Manual Package Included: 1 X Screen Protector 1 X Cleaning Wipes 1 X Cleaning Cloth 1 X Dust-absorber 3 X Guide Stickers Click here for more deals Cluster Scratch Protection Film Screen Protector For Ducati Multistrada 15-17 Cluster Scratch Protection Film Screen Protector For Ducati Multistrada 15-17
R 261
See product
South Africa
Description: Precise cut to fit perfectly on HONDA NC750X// NC700X 2016-2017 cluster screen Made from Crystal Clear premium TPU film Protects cluster screen from scratches, limescale, impact, heat and UV Seals existing scratches underneath and makes the cluster screen shines like new again Easy to clean and wipe the dirt off without the fear to scratch the cluster screen Leaves no glue or residue when removed Specification: Product: Motorcycle Instrument Screen Protector Material: Thermoplastic polyurethanes(TPU) Color: Clear Size: As the picture shows Method of Application: The meter is cleaned, the number 1 at the end of tear film, and then in the middle of the film is sprayed with appropriate water, put in the car in the middle of the water meter, scrape shift positions, shave after the 2 top film (yellow) with a slight tear, blisters, after 24 hours will be eliminated. Note: Comes with Cleaning kit, Squeegee and Detailed Instruction Manual Package Included: 1 X Screen Protector 1 X Cleaning Wipes 1 X Cleaning Cloth 1 X Dust-absorber 3 X Guide Stickers
See product
South Africa
Description: Precise cut to fit perfectly on HONDA NC750X// NC700X 2016-2017 cluster screen Made from Crystal Clear premium TPU film Protects cluster screen from scratches, limescale, impact, heat and UV Seals existing scratches underneath and makes the cluster screen shines like new again Easy to clean and wipe the dirt off without the fear to scratch the cluster screen Leaves no glue or residue when removed Specification: Product: Motorcycle Instrument Screen Protector Material: Thermoplastic polyurethanes(TPU) Color: Clear Size: As the picture shows Method of Application: The meter is cleaned, the number 1 at the end of tear film, and then in the middle of the film is sprayed with appropriate water, put in the car in the middle of the water meter, scrape shift positions, shave after the 2 top film (yellow) with a slight tear, blisters, after 24 hours will be eliminated. Note: Comes with Cleaning kit, Squeegee and Detailed Instruction Manual Package Included: 1 X Screen Protector 1 X Cleaning Wipes 1 X Cleaning Cloth 1 X Dust-absorber 3 X Guide Stickers
See product
South Africa
Description: Precise cut to perfect fit for Yamaha YZF R3 / MT-03 cluster screen Made from Crystal Clear premium TPU film Protects cluster screen from scratches, dust, debris, heat and UV Seals existing scratches underneath and makes the cluster screen like new again Easy to clean and wipe the dirt off without the fear to scratch the cluster screen Leave no residue when removed Specification: Material: Thermoplastic Polyurethanes(TPU) Fitment: For BMW R1200GS ADV Package Included: 1 X Cleaning Wipe 1 X Cleaning Cloth 1 X Dust-absorber 3 X Guide Stickers
See product
South Africa (All cities)
Description: Instrument protective film adopts high quality TPU explosion-proof membrane Protect the cluster screen from scratches, dust, debris, heat and ultraviolet light Easy to clean and erase dirt, no fear, scratches cluster screen Leave no residue when removed Equipped with cleaning kit and scraping Specification: Product: Motorcycle Instrument Screen Protector Material: Thermoplastic polyurethanes(TPU) Color: Clear Size: 158mm * 110mm Fitment: For Ducati Multistrada 1200 2015-2016 For Ducati Multistrada 1200 S 2015-2017 Method of Application: The meter is cleaned, the number 1 at the end of tear film, and then in the middle of the film is sprayed with appropriate water, put in the car in the middle of the water meter, scrape shift positions, shave after the 2 top film (yellow) with a slight tear, blisters, after 24 hours will be eliminated. Note: Comes with Cleaning kit, Squeegee and Detailed Instruction Manual Package Included: 1 X Screen Protector 1 X Cleaning Wipes 1 X Cleaning Cloth 1 X Dust-absorber 3 X Guide Stickers
R 250
See product
South Africa
Description: Precise cut to fit perfectly for Yamaha XSR900 2016-2017 cluster screen Made from Crystal Clear premium TPU film Protects cluster screen from scratches, limescale, impact, heat and UV Seals existing scratches underneath and makes the cluster screen shines like new again Easy to clean and wipe the dirt off without the fear to scratch the cluster screen Leaves no glue or residue when removed Specification: Product: Motorcycle Instrument Screen Protector Material: Thermoplastic polyurethanes(TPU) Color: Clear Size: 9cm/3.5'' Method of Application: The meter is cleaned, the number 1 at the end of tear film, and then in the middle of the film is sprayed with appropriate water, put in the car in the middle of the water meter, scrape shift positions, shave after the 2 top film (yellow) with a slight tear, blisters, after 24 hours will be eliminated. Note: Comes with Cleaning kit, Squeegee and Detailed Instruction Manual. Package Included: 1 X Screen Protector 1 X Cleaning Wipes 1 X Cleaning Cloth 1 X Dust-absorber 3 X Guide Stickers
See product
South Africa
Description: Precise cut to fit perfectly for Kawasaki Z900/Z650 2017 cluster screen Made from Crystal Clear premium TPU film Protects cluster screen from scratches, limescale, impact, heat and UV Seals existing scratches underneath and makes the cluster screen shines like new again Easy to clean and wipe the dirt off without the fear to scratch the cluster screen Leaves no glue or residue when removed Specification: Product: Motorcycle Instrument Screen Protector Material: Thermoplastic polyurethanes(TPU) Color: Clear Size: As the picture shows Method of Application: The meter is cleaned, the number 1 at the end of tear film, and then in the middle of the film is sprayed with appropriate water, put in the car in the middle of the water meter, scrape shift positions, shave after the 2 top film (yellow) with a slight tear, blisters, after 24 hours will be eliminated. Note: Comes with Cleaning kit, Squeegee and Detailed Instruction Manual Package Included: 1 X Screen Protector 1 X Cleaning Wipes 1 X Cleaning Cloth 1 X Dust-absorber 3 X Guide Stickers
See product
South Africa (All cities)
Motorcycle Meter Cluster Scratch Protection Film Screen Protector For Yamaha FZ Package weight: 0.13 kg Description: Cluster Scratch Protection Film / Screen Protector For Yamaha FZ-10 / MT-10 Precise cut to perfect fit for Yamaha FZ-10 / MT-10 cluster screen Made from Crystal Clear premium TPU film Protects cluster screen from scratches, dust, debris, heat and UV Seals existing scratches underneath and makes the cluster screen like new again Easy to clean and wipe the dirt off without the fear to scratch the cluster screen Leave no residue when removed Specification: Name:Motorcycle Instrument Screen Protector Material: Thermoplastic polyurethanes(TPU) Size(L*Middle width): approx.16.9*6.9cm Widest: approx.7cm Package Included: 1 X Screen Protector 1 X Cleaning Wipes 1 X Cleaning Cloth 1 X Dust-absorber 3 X Guide Sticker Click here for more deals Motorcycle Meter Cluster Scratch Protection Film Screen Protector For Yamaha FZ Motorcycle Meter Cluster Scratch Protection Film Screen Protector For Yamaha FZ
R 286
See product
South Africa
Description: Precise cut to perfect fit for HONDA AFRICA TWIN CRF1000L cluster screen Made from Crystal Clear premium TPU film Protects cluster screen from scratches, dust, debris, heat and UV Seals existing scratches underneath and makes the cluster screen like new again Easy to clean and wipe the dirt off without the fear to scratch the cluster screen Leave no residue when removed Specification: Material: Thermoplastic polyurethanes(TPU) Fitment: For HONDA AFRICA TWIN CRF1000L Package Included: 1 X Screen Protector 1 X Cleaning Wipes 1 X Cleaning Cloth 1 X Dust-absorber 3 X Guide Sticker
See product
South Africa (All cities)
Car Vehicle Chic VDO LCD Cluster Speedometer Display Screen for Audi A3 A4 A6 Package weight: 0.02 kg Feature: Easy to install, direct fits. LCD v2 Replacement Screen. Clear Display for the Gauge. A Perfect replacement for your original screen. Ribbon cable required to fix the problem. Save thousands on a dash with missing pixels, replace just the lcd. Requires soldering by an experienced professional. Specification: Material: TFT Size: About 7.4cmx5.7cm Fit For Audi A3 A4 A6 1999-2005 Package Included: 1 X LCD Display Screen Click here for more deals Car Vehicle Chic VDO LCD Cluster Speedometer Display Screen for Audi A3 A4 A6 Car Vehicle Chic VDO LCD Cluster Speedometer Display Screen for Audi A3 A4 A6
R 314
See product
South Africa (All cities)
Feature: 1. Easy to install, direct fits 2. Clear display for the gauge 3. Save thousands on a dash with missing pixels, replace just the lcd 4. There is a protective film on both sides to protect the lcd during transport Specification: Name Vehicle Car VDO LCD Cluster Speedometer Display Screen For Audi A3 A4 A6 Material Glass + Metal Size 7.5CM x 6CM Package Included: 1 X LCD Display Screen
R 302
See product
South Africa (All cities)
Description: Precise cut to perfect fit for Honda CBR500 R/F/X cluster screen Made from Crystal Clear premium TPU film Protects cluster screen from scratches, dust, debris, heat and UV Seals existing scratches underneath and makes the cluster screen like new again Easy to clean and wipe the dirt off without the fear to scratch the cluster screen Leave no residue when removed Specification: Name: Motorcycle Instrument Screen Protector Material: Thermoplastic polyurethanes(TPU) Size: approx.16.9cm Package Included: 1 X Screen Protector 1 X Cleaning Wipes 1 X Cleaning Cloth 1 X Dust-absorber 3 X Guide Sticker
R 192
See product
South Africa (All cities)
VAG K+CAN Commander 1.4 with FT232RL chip OBD2 Diagnostic Interface Brand New Software version 1.4 Diagnostics/Immobilizer/Key programming/Mileage R499 Available for Countrywide Postage. VAG K+CAN Commander Software Version 1.4 (It covers VW/SEAT/SKODA (CAN) up to September 2006 while AUDI covered up to 2007) Features: 1. Diagnostic via CAN-and Special-Function via K-Line. 2. Covers all electronic control units in vehicles (diagnostic addresses from 0x01 to 0x80). This can allow of user to investigate and diagnosis some new units untouchable for remaining diagnostic tools. Functions are under CAN-TP2.0. 3. Manual definition of running diagnostic session C not like remaining diagnostic tools always standard diagnostic session 0x89. Function is under CAN-TP2.0. 4. Broadcast diagnostic request disable normal communication, clear DTCs, Logistic (transport) mode. Functions are under CAN-TP2.0. 5. Allows managing of brand new units (and immobilizer units) where is allowed programming of PIN, SKC, BGW, MAC. Functions are under CAN-TP2.0. 6. Most of popular diagnostic requests identifications, coding, adaptations, DTCs. Functions are under CAN-TP2.0. Function: 1.Odometer repair in instrument clusters and EDC15x. 2.Read Security Access Code/Login WFS. 3.Read/program immobilizer data. 4.Read/write EEPROM from instrument cluster/immobilizer. All supported clusters CAN/K. 5.VAG MMI TV Activation. 6.Read/Write EEPROM of Engine Control Units BOSCH VAG-EDC15x, VAG-ME7.1.1, VAG-Cartronic ME7.8, Porsche. 7.Key learning buttons for easy usage (not needed security code). Can do component security authorization. 8.Key learning Porsche CAYENNE (not needed security code) K+CAN. 9.Custom memory reading from different units like ECUs, EZS-Kessy and xxxxx. 10.Reading flash memories EDC16x, EDC15x, ME7x, MED951, MED751 (with next update will be possible programming of flash memories 11.Crash data clear in airbag units List of vehicles covered for odometer repair via OBDII: Audi Q7 (CAN) Audi A2 (K) Audi A3 (CAN) bis zu 2007! Audi A3 VDO/M73 bis 2003 (K) Audi A4 VDO/M73 (K) Audi A4 BOSCH - RB4 Cluster (CRYPTO EEPROMs R / W von OBDII) Audi A6 VDO (K) Audi A6 (CAN) Audi Allroud (K) bis 2004 Audi A8 (K) VDO93xx Audi A8 (CAN) bis zu 2007! Audi TT (K) Seat Alhambra (K) Seat Altea (CAN) Seat Arosa (K) Seat Cordoba nach 1999 (K) Seat Ibiza VDO nach 1999 (K) Seat Leon (K + CAN) Seat Toledo (K + CAN) Skoda Octavia (K) Skoda Octavia II (CAN) Skoda Superb (K) Skoda Roomster (K) Skoda Scout (CAN) Skoda Fabia (K) VW Bora (K) VW-Käfer (K) VW Caddy (CAN) VW EOS (CAN) VW Golf4 VDO / Motometer / Bosch RB VW Golf5 VDO (CAN) VW CrossGolf (CAN) VW Individual (CAN) VW Jetta (K + CAN) VW Passat B5/B6 (K + CAN) VW Polo VDO / Motometer (K) VW Sharan (K) VW T4/T5 VDO (K) VW Touaran VDO (CAN) List of vehicles covered for security access code/login reading via OBDII: Audi A3 (CAN) bis zu 2007! Audi A3 VDO/M73 bis 2003 (K) Audi A4 VDO (K) Audi A4 BOSCH (K) bis 2001 Audi A4 nach 2000 - Benzin-Motoren> = 1,8 Audi A6 VDO (K) Audi A6 (CAN) Benzin-Motoren Audi Allroad (K) bis 2004 Audi Allroad (CAN) Benzin-Motoren Audi A8 bis 2001 Audi A8 von 2001 bis 2002 2.5TDI Audi A8 (CAN) 2003 + Benzin Audi TT (K) Audi Q7 Benzinmotoren Seat Altea (CAN) Seat Cordoba nach 1999 (K) Seat Ibiza (VDO) nach 1999 (K) Seat Leon (K + CAN) Seat Toledo (K + CAN) Skoda Octavia Skoda Octavia II (CAN) Skoda Superb Skoda Roomster Skoda Scout (CAN) Skoda Fabia VW Bora VW-Käfer VW Caddy (CAN) VW EOS (CAN) VW Golf4 VDO / Motometer / Bosch RB VW Golf5 VDO (CAN) VW CrossGolf (CAN) VW Individual (CAN) VW Jetta (K + CAN) VW Passat B5 (K) B6 (CAN) VW Polo5 VW Sharan Jahr 2000 VW T5 VW Phaeton Benzin VW Touareg Benzin VW Touaran VDO (CAN) Porsche Cayenne (CAN / K) Package list: 1pc x K+CAN 1.4 Cable 1pc x CD Drive
R 499
See product
South Africa
This product is dispatched in 1 to 3 working days --------------------------------------- ICARSOFT MULTI-SYSTEM SCANNER & OIL RESET I910-II FOR BMW/MINI - I910 II i910 Series is a new vehicle fault diagnostic tool developed by Icarsoft Technology Inc.. Specially for DIY users and the servicemen of small service factories. This product supplies color LCD display and personalized function menu. It supports BMW 1 Series, 3 Series, 5 Series, 6 Series, 7 series, 8 series, X series, Z series and Mini. The supported system includes Engine, Auto Transmission, ABS, Air bag, Air condition, Instrument cluster, Elec. immobilize system, ect. Six Super Advantages: 1.THE FASTEST FULL COLOR, 2.8 LCD SCREEN PROFESSIONAL BMW Multi-system Scanner! USB 2.0 High Speed Upgrade i910 Supports BMW between 1997 to 2011 1 Series 1'_E81/E82/E87/E88 3 Series 3'/Z3_E36, 3'_E46 3'_E90/E91/E92/E93 5 Series 5'_E395'_E60/E61 6 Series 6'_E63/E64 7 Series 7'_E387'_E65/E66 X Series X1_E84 X3_E83 X5_E53 X5_E70 X6_E71 Z Series 3'/Z3_E36Z4 E85/E86 Z4 E89 MINI:MINI_R50/R52/R53, MINI R55/R56 Include:Drive, Chassis and Body all system Function include: a) Read & Clear DTCs b) View & Graph Live Data in Color Graphing and blazing fast refresh rate for better graphing and live data readings. c) BMW ECU information d) And More! See Users Manual Oil Reset Clearing Adaption Product Function: Read Trouble Codes Clear Trouble Codes Read Live Data Component Testing Clear adaptation Vehicle information Datastream Graph Display Oil Reset Clearing Adaption Specifications: A) Display: 2.8 Color screen, 320 x 240 pixel display with contrast adjustment B) Operation Temperature: -20 -- 75 C) Storage Temperature: -40 -- 120 D) Power: 8V -- 24V Dimensions: L * W * H: 135mm * 85 mm * 26mm Net Weight: 250g Gross Weight: 450g Applicable system include: DMEEGSABSSRSIHKA/IHKRIKE/IKI/KOMBIEMLSPM/SMEWSZKE GRPDCSZMBITLSZ/LCMLEW RADEHC/EDCBMAICNAVMFLVIDSESMIDSHD SMFSPMBTSPMFTVTGCIDEPSSBSLSBSR CVMSIMSMBURSRDCVMXVNC EKMDWAXENFHKGSAAHKADSCASDMEEGSVTCHPFI ACCARSCIMDSC EDCEHCEMFRDCAHLAHMAMPASKSZM/BZMFBZMCDCD-GWSG-FD SG-FD- GWFDCDCCONFCONDWAFBIIHKAFKAHKLJBITKHIKOMLMDVD-CNAV JNAV PDCCAPM/MPMRLSSASLSASRSBSLSBSRSFZSSBFSSFASSHSTVL STVRSHDSINESMFA SMBFSMFAHSMBFHSHZHSVSSZLSECTELTCUTMBF TTMBFHTMFATTMFAHVMWIMZGMSIM KBMSBSLSBSRTMFATMBFCIDAL JBEMRS/ACSMFRMRLSFZDCCC-ANTDDECCC-AEKPSGWS VTGVTCVTC2 CCC-ASKALEDCSHLEDCSHREDCSVLEDCSVRVDMACSMAMPHAMPTCACCC-BO CCC-GWCHAMP-BOCHAMP-GWCNAVDABFDFLAFRM2FZDHUDIBOCIHKAINS TRJBE2KHMKNAV M-ASK-BOM-ASK-GWRFKRLSSRSESDARSSINEULF-SBX ULF-SBX-HVSWEHCULFIHKRIHRM-ASK- NAV MRSRAD2-BORAD2-GWSDMRS DME2ACC2ANTARSBZMCDCEMCIM2LM2 AHL2LM2LM2 NVENVK PMSEC 2SGM-SIMSGM-ZGMVTC2ZBMDSCDSCALBBFALBFACICCIC-GWIHKA2KGM SZL2LDMLRR MPMSMGTLCIntegrate Chas ManagRol-mo disrear axleABS /ACS/DSCAMPIHKSIHS MJOYAIRBAGEWS. Contents:
R 1.999
See product
South Africa
iCarsoft Multi-system Scanner & Oil Reset i910-II for BMW/Mini - i910 II i910 Series is a new vehicle fault diagnostic tool developed by Icarsoft Technology Inc.. Specially for DIY users and the servicemen of small service factories. This product supplies color LCD display and personalized function menu. It supports BMW 1 Series, 3 Series, 5 Series, 6 Series, 7 series, 8 series, X series, Z series and Mini. The supported system includes Engine, Auto Transmission, ABS, Air bag, Air condition, Instrument cluster, Elec. immobilize system, ect. Six Super Advantages: 1.THE FASTEST FULL COLOR, 2.8 LCD SCREEN PROFESSIONAL BMW Multi-system Scanner! USB 2.0 High Speed Upgrade i910 Supports BMW between 1997 to 2011 1 Series 1'_E81/E82/E87/E88 3 Series 3'/Z3_E36, 3'_E46 3'_E90/E91/E92/E93 5 Series 5'_E395'_E60/E61 6 Series 6'_E63/E64 7 Series 7'_E387'_E65/E66 X Series X1_E84 X3_E83 X5_E53 X5_E70 X6_E71 Z Series 3'/Z3_E36Z4 E85/E86 Z4 E89 MINI:MINI_R50/R52/R53, MINI R55/R56 Include:Drive, Chassis and Body all system Function include: a) Read & Clear DTCs b) View & Graph Live Data in Color Graphing and blazing fast refresh rate for better graphing and live data readings. c) BMW ECU information d) And More! See Users Manual Oil Reset Clearing Adaption Product Function: Read Trouble Codes Clear Trouble Codes Read Live Data Component Testing Clear adaptation Vehicle information Datastream Graph Display Oil Reset Clearing Adaption Specifications: A) Display: 2.8 Color screen, 320 x 240 pixel display with contrast adjustment B) Operation Temperature: -20 -- 75 C) Storage Temperature: -40 -- 120 D) Power: 8V -- 24V Dimensions: L * W * H: 135mm * 85 mm * 26mm Net Weight: 250g Gross Weight: 450g Applicable system include: DMEEGSABSSRSIHKA/IHKRIKE/IKI/KOMBIEMLSPM/SMEWSZKE GRPDCSZMBITLSZ/LCMLEW RADEHC/EDCBMAICNAVMFLVIDSESMIDSHD SMFSPMBTSPMFTVTGCIDEPSSBSLSBSR CVMSIMSMBURSRDCVMXVNC EKMDWAXENFHKGSAAHKADSCASDMEEGSVTCHPFI ACCARSCIMDSC EDCEHCEMFRDCAHLAHMAMPASKSZM/BZMFBZMCDCD-GWSG-FD SG-FD- GWFDCDCCONFCONDWAFBIIHKAFKAHKLJBITKHIKOMLMDVD-CNAV JNAV PDCCAPM/MPMRLSSASLSASRSBSLSBSRSFZSSBFSSFASSHSTVL STVRSHDSINESMFA SMBFSMFAHSMBFHSHZHSVSSZLSECTELTCUTMBF TTMBFHTMFATTMFAHVMWIMZGMSIM KBMSBSLSBSRTMFATMBFCIDAL JBEMRS/ACSMFRMRLSFZDCCC-ANTDDECCC-AEKPSGWS VTGVTCVTC2 CCC-ASKALEDCSHLEDCSHREDCSVLEDCSVRVDMACSMAMPHAMPTCACCC-BO CCC-GWCHAMP-BOCHAMP-GWCNAVDABFDFLAFRM2FZDHUDIBOCIHKAINS TRJBE2KHMKNAV M-ASK-BOM-ASK-GWRFKRLSSRSESDARSSINEULF-SBX ULF-SBX-HVSWEHCULFIHKRIHRM-ASK- NAV MRSRAD2-BORAD2-GWSDMRS DME2ACC2ANTARSBZMCDCEMCIM2LM2 AHL2LM2LM2 NVENVK PMSEC 2SGM-SIMSGM-ZGMVTC2ZBMDSCDSCALBBFALBFACICCIC-GWIHKA2KGM SZL2LDMLRR MPMSMGTLCIntegrate Chas ManagRol-mo disrear axleABS /ACS/DSCAMPIHKSIHS MJOYAIRBAGEWS. Contents: Hardcopy Users Manual 6-foot OBD II cable CD software USB cable Nylon carry case
R 2.399
See product
-
Next →